Loading...
Statistics
Advertisement

Whiff of Cordite | The Rugby Nerd's Blog
www.whiffofcordite.com/
The Rugby Nerd's Blog

Whiffofcordite.com

Advertisement
Conversion Technology Metas Server
Whiffofcordite.com is hosted in United States / San Francisco . Whiffofcordite.com uses HTTPS protocol. Number of used technologies: 6. First technologies: CSS, Gravatar, Html, Number of used javascripts: 5. First javascripts: Gprofiles.js, Wpgroho.js, Widgets.js, Number of used analytics tools: 1. First analytics tools: ComScore, Its server type is: nginx. Its CMS is: Wordpress.

Technologies in use by Whiffofcordite.com

Technology

Number of occurences: 6
  • CSS
  • Gravatar
  • Html
  • Javascript
  • Php
  • Pingback

Advertisement

Javascripts

Number of occurences: 5
  • gprofiles.js
  • wpgroho.js
  • widgets.js
  • 725X1342.skimlinks.js
  • w.js

Content Management System

Number of occurences: 1
  • Wordpress

Analytics

Number of occurences: 1
  • comScore

Advertise

Number of occurences: 1
  • Skimlinks

Server Type

  • nginx

Social

Number of occurences: 2
  • Facebook Box
  • Twitter Button

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Whiffofcordite.com

SSL certificate

    • name: /CN=tls.automattic.com
    • subject:
      • CN: tls.automattic.com
    • hash: 6338c477
    • issuer:
      • C: US
      • O: Let's Encrypt
      • CN: Let's Encrypt Authority X3
    • version: 2
    • serialNumber: 297595277161820265874349418054836283398813
    • validFrom: 160404130800Z
    • validTo: 160703130800Z
    • validFrom_time_t: 1459775280
    • validTo_time_t: 1467551280
    • extensions:
      • keyUsage: Digital Signature, Key Encipherment
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • basicConstraints: CA:FALSE
      • subjectKeyIdentifier: ED:4E:EE:D6:E8:26:D4:AA:ED:70:52:76:0F:DE:02:20:99:C7:38:B6
      • authorityKeyIdentifier: keyid:A8:4A:6A:63:04:7D:DD:BA:E6:D1:39:B7:A6:45:65:EF:F3:A8:EC:A1
      • authorityInfoAccess: OCSP - URI:http://ocsp.int-x3.letsencrypt.org/ CA Issuers - URI:http://cert.int-x3.letsencrypt.org/
      • subjectAltName: DNS:tls.automattic.com, DNS:whetstoneandassociates.com, DNS:whetstoneathletics.com, DNS:whetyourwanderlust.com, DNS:whetyourwoman.com, DNS:whetzgood.com, DNS:whey-protein-info.com, DNS:wheyinonthecurds.com, DNS:wheymouthbohemian.com, DNS:whf-pa.org, DNS:whfarmacy.com, DNS:whgoftampa.com, DNS:whhealthandfitness.com, DNS:whichcraftandwhimsy.com, DNS:whichdigitalblog.com, DNS:whichhalfoftheglass.com, DNS:whichmitch.com, DNS:whichonesam.com, DNS:whichsailboat.com, DNS:whichshoestoday.com, DNS:whichwayisup.me, DNS:whichwaytomongolia.com, DNS:whidbeybicycleclub.org, DNS:whidbeycarenet.org, DNS:whidbeyfocus.com, DNS:whidbeyislandcarpentry.com, DNS:whidbeyislandelectricbikerentals.com, DNS:whidbeyislandgirl.net, DNS:whidbeyislandtreasurehunt.com, DNS:whidbeyislandyoga.com, DNS:whidbeymothermentors.org, DNS:whidbeystudents.com, DNS:whidbeywildlifehabitat.com, DNS:whiffofcordite.com, DNS:whifftestbuddysystem.com, DNS:while-here.com, DNS:while-you-were-sleeping.com, DNS:whileatoxford.com, DNS:whileatthezoo.com, DNS:whileawaytheday.com, DNS:whileawaythehoursblog.com, DNS:whiledarceysleeps.com, DNS:whileguide.com, DNS:whilehavingtea.com, DNS:whileiamthinkingaboutit.com, DNS:whileifelse.com, DNS:whileimwaitingblog.com, DNS:whileinaustralia.com, DNS:whileinheels.com, DNS:whileiwasreading.com, DNS:whilemaandpawsawaypetservices.com
      • certificatePolicies: Policy: 2.23.140.1.2.1 Policy: 1.3.6.1.4.1.44947.1.1.1 CPS: http://cps.letsencrypt.org User Notice: Explicit Text: This Certificate may only be relied upon by Relying Parties and only in accordance with the Certificate Policy found at https://letsencrypt.org/repository/

Meta - Whiffofcordite.com

Number of occurences: 9
  • Name:
    Content: en_US
  • Name: generator
    Content: WordPress.com
  • Name: twitter:site
    Content: @wordpressdotcom
  • Name: application-name
    Content: Whiff of Cordite
  • Name: msapplication-window
    Content: width=device-width;height=device-height
  • Name: msapplication-tooltip
    Content: The Rugby Nerd's Blog
  • Name: msapplication-task
    Content: name=WordPress.com Forums;action-uri=http://forums.wordpress.com/;icon-uri=https://s2.wp.com/i/favicon.ico
  • Name: title
    Content: Whiff of Cordite on WordPress.com
  • Name: description
    Content: The Rugby Nerd's Blog

Server / Hosting

  • IP: 192.0.78.24
  • Latitude: 37.75
  • Longitude: -122.42
  • Country: United States
  • City: San Francisco

Rname

  • ns3.wordpress.com
  • ns1.wordpress.com
  • ns2.wordpress.com

Target

  • hostmaster.wordpress.com

HTTP Header Response

HTTP/1.1 301 Moved Permanently Server: nginx Date: Tue, 07 Jun 2016 01:07:45 GMT Content-Type: text/html Content-Length: 178 Location: https://whiffofcordite.com/ X-ac: 3.bur _bur X-Cache: MISS from s_bd39 X-Cache-Lookup: MISS from s_bd39:80 Via: 1.1 s_bd39 (squid/3.5.19) Connection: keep-alive HTTP/1.1 200 Connection established HTTP/1.1 200 OK Server: nginx Date: Tue, 07 Jun 2016 01:07:45 GMT Content-Type: text/html; charset=UTF-8 Connection: keep-alive Strict-Transport-Security: max-age=86400 Vary: Accept-Encoding Vary: Cookie X-hacker: If you're reading this, you should visit automattic.com/jobs and apply to join the fun, mention this header. Link: ; rel=shortlink X-ac: 3.bur _bur

DNS

host: whiffofcordite.com
  1. class: IN
  2. ttl: 300
  3. type: A
  4. ip: 192.0.78.25
host: whiffofcordite.com
  1. class: IN
  2. ttl: 300
  3. type: A
  4. ip: 192.0.78.24
host: whiffofcordite.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns3.wordpress.com
host: whiffofcordite.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns1.wordpress.com
host: whiffofcordite.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns2.wordpress.com
host: whiffofcordite.com
  1. class: IN
  2. ttl: 86400
  3. type: SOA
  4. mname: ns1.wordpress.com
  5. rname: hostmaster.wordpress.com
  6. serial: 2005071858
  7. refresh: 14400
  8. retry: 7200
  9. expire: 604800
  10. minimum-ttl: 300

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.hiffofcordite.com, www.w hiffofcordite.com, www. hiffofcordite.com, www.wchiffofcordite.com, www.chiffofcordite.com, www.whiffofcordite.com, www.hiffofcordite.com, www.wdhiffofcordite.com, www.dhiffofcordite.com, www.wfhiffofcordite.com, www.fhiffofcordite.com, www.wghiffofcordite.com, www.ghiffofcordite.com, www.wbhiffofcordite.com, www.bhiffofcordite.com, www.wiffofcordite.com, www.wheiffofcordite.com, www.weiffofcordite.com, www.whdiffofcordite.com, www.wdiffofcordite.com, www.whciffofcordite.com, www.wciffofcordite.com, www.whuiffofcordite.com, www.wuiffofcordite.com, www.whjiffofcordite.com, www.wjiffofcordite.com, www.whiffofcordite.com, www.wiffofcordite.com, www.whbiffofcordite.com, www.wbiffofcordite.com, www.whgiffofcordite.com, www.wgiffofcordite.com, www.whffofcordite.com, www.whirffofcordite.com, www.whrffofcordite.com, www.whifffofcordite.com, www.whfffofcordite.com, www.whivffofcordite.com, www.whvffofcordite.com, www.whikffofcordite.com, www.whkffofcordite.com, www.whi,ffofcordite.com, www.wh,ffofcordite.com, www.whibffofcordite.com, www.whbffofcordite.com, www.whigffofcordite.com, www.whgffofcordite.com, www.whitffofcordite.com, www.whtffofcordite.com, www.whiyffofcordite.com, www.whyffofcordite.com, www.whiuffofcordite.com, www.whuffofcordite.com, www.whijffofcordite.com, www.whjffofcordite.com, www.whimffofcordite.com, www.whmffofcordite.com, www.whinffofcordite.com, www.whnffofcordite.com, www.whifofcordite.com, www.whifqfofcordite.com, www.whiqfofcordite.com, www.whiffofcordite.com, www.whifofcordite.com, www.whifafofcordite.com, www.whiafofcordite.com, www.whifyfofcordite.com, www.whiyfofcordite.com, www.whiftfofcordite.com, www.whitfofcordite.com, www.whifgfofcordite.com, www.whigfofcordite.com, www.whifbfofcordite.com, www.whibfofcordite.com, www.whifwfofcordite.com, www.whiwfofcordite.com, www.whifsfofcordite.com, www.whisfofcordite.com, www.whifdfofcordite.com, www.whidfofcordite.com, www.whifrfofcordite.com, www.whirfofcordite.com, www.whif3fofcordite.com, www.whi3fofcordite.com, www.whif4fofcordite.com, www.whi4fofcordite.com, www.whifofcordite.com, www.whiffqofcordite.com, www.whifqofcordite.com, www.whiffofcordite.com, www.whifofcordite.com, www.whiffaofcordite.com, www.whifaofcordite.com, www.whiffyofcordite.com, www.whifyofcordite.com, www.whifftofcordite.com, www.whiftofcordite.com, www.whiffgofcordite.com, www.whifgofcordite.com, www.whiffbofcordite.com, www.whifbofcordite.com, www.whiffwofcordite.com, www.whifwofcordite.com, www.whiffsofcordite.com, www.whifsofcordite.com, www.whiffdofcordite.com, www.whifdofcordite.com, www.whiffrofcordite.com, www.whifrofcordite.com, www.whiff3ofcordite.com, www.whif3ofcordite.com, www.whiff4ofcordite.com, www.whif4ofcordite.com, www.whifffcordite.com, www.whiffobfcordite.com, www.whiffbfcordite.com, www.whiffohfcordite.com, www.whiffhfcordite.com, www.whiffogfcordite.com, www.whiffgfcordite.com, www.whiffojfcordite.com, www.whiffjfcordite.com, www.whiffomfcordite.com, www.whiffmfcordite.com, www.whiffo fcordite.com, www.whiff fcordite.com, www.whiffovfcordite.com, www.whiffvfcordite.com, www.whiffocordite.com, www.whiffofqcordite.com, www.whiffoqcordite.com, www.whiffofcordite.com, www.whiffocordite.com, www.whiffofacordite.com, www.whiffoacordite.com, www.whiffofycordite.com, www.whiffoycordite.com, www.whiffoftcordite.com, www.whiffotcordite.com, www.whiffofgcordite.com, www.whiffogcordite.com, www.whiffofbcordite.com, www.whiffobcordite.com, www.whiffofwcordite.com, www.whiffowcordite.com, www.whiffofscordite.com, www.whiffoscordite.com, www.whiffofdcordite.com, www.whiffodcordite.com, www.whiffofrcordite.com, www.whifforcordite.com, www.whiffof3cordite.com, www.whiffo3cordite.com, www.whiffof4cordite.com, www.whiffo4cordite.com, www.whiffofordite.com, www.whiffofcdordite.com, www.whiffofdordite.com, www.whiffofcrordite.com, www.whiffofrordite.com, www.whiffofctordite.com, www.whiffoftordite.com, www.whiffofcvordite.com, www.whiffofvordite.com, www.whiffofcfordite.com, www.whiffoffordite.com, www.whiffofcgordite.com, www.whiffofgordite.com, www.whiffofchordite.com, www.whiffofhordite.com, www.whiffofcnordite.com, www.whiffofnordite.com, www.whiffofcmordite.com, www.whiffofmordite.com, www.whiffofcjordite.com, www.whiffofjordite.com,

Other websites we recently analyzed

  1. Ludovic-Soranzo.com - Chef opérateur / Cadreur / Electro
    Germany - 212.227.247.84
    Server software: Apache
    Technology: CSS, Flexslider, Html, Html5, Javascript, jQuery, Php, Pingback, W3 Total cache, Wordpress
    Number of Javascript: 6
    Number of meta tags: 3
  2. Find Jobs, Housing, Information, Support, and more for Felons
    Felon Help Services helps you find felon-related help services, worldwide
    San Francisco (United States) - 104.31.243.10
    Server software: cloudflare-nginx
    Technology: CloudFlare, Google Adsense, CSS, Gravatar, Html, Javascript, Php, Google Analytics, Tynt Insight, Joomla
    Number of Javascript: 12
    Number of meta tags: 5
  3. momely.com
    Scottsdale (United States) - 50.63.202.41
    Server software: Microsoft-IIS/7.5
    Technology: Html, Html5, Iframe
  4. Amazing Grace Bakery and Cafe
    Chicago (United States) - 216.86.156.1
    Server software: Apache/2.2
    Technology: CSS, Google Font API, Gravatar, Html, Javascript, jQuery, Php, Pingback, SuperFish, Google Analytics, Wordpress
    Number of Javascript: 12
    Number of meta tags: 2
  5. CaRACS - Clinical and Regulatory Affairs Consulting Services
    CaRACS - Clinical and Regulatory Affairs Consulting Services, is dedicated to Clinical Development Strategy and Regulatory Affairs Consulting Services for biotechnology and pharmaceutical industries.
    Berlin (Germany) - 81.169.145.72
    Server software: Apache/2.2.31 (Unix)
    Technology: CSS, Html, Php
    Number of meta tags: 4
  6. littleneckvetclinic
    Ashburn (United States) - 52.203.203.182
    Server software: Pepyaka/1.9.13
    Technology: CSS, Html, Html5, Javascript, Wix
    Number of Javascript: 2
    Number of meta tags: 5
  7. Otomobile Dair Ne Varsa | Otomobil dünyasının vazgeçilmezleri burada
    Sanayi (Turkey) - 185.90.240.99
    G Analytics ID: UA-75267194-1
    Server software: Microsoft-IIS/8.5
    Technology: CSS, Gravatar, Html, Javascript, jQuery, Php, Pingback, Google Analytics, WordPress Stats, Wordpress
    Number of Javascript: 12
    Number of meta tags: 3
  8. My Blog
    Chicago (United States) - 37.60.253.107
    Server software: nginx
    Technology: CSS, Html, Html5, Javascript, jQuery, Php, Pingback, SVG, Wordpress
    Number of Javascript: 6
    Number of meta tags: 3
  9. Cara Mengobati Darah Tinggi
    Cara Mengobati Penyakit Tekanan Darah Tinggi dan Mengatasi Darah Tinggi
    Houston (United States) - 192.185.20.34
    Server software: nginx/1.10.1
    Technology: CSS, Html, Html5, Javascript, Php, Pingback, Wordpress
    Number of Javascript: 1
    Number of meta tags: 5
  10. Aileen's Gaming Corner – An Awesome Gaming Blog!
    Scottsdale (United States) - 104.238.127.120
    Server software: Apache/2.2.31 (Unix) mod_ssl/2.2.31 OpenSSL/1.0.1e-fips mod_bwlimited/1.4
    Technology: CSS, Html, Html5, Javascript, jQuery, Php, Pingback, Wordpress, Facebook Box, Google +1 Button
    Number of Javascript: 17
    Number of meta tags: 3

Check Other Websites